Anti PTRH2 pAb (ATL-HPA012897)

Atlas Antibodies

Catalog No.: ATL-HPA012897-25

Protein Description: peptidyl-tRNA hydrolase 2
Gene Name: PTRH2
Alternative Gene Name: BIT1, CFAP37, CGI-147, PTH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072582: 81%, ENSRNOG00000004288: 83%
Entrez Gene ID: 51651
Uniprot ID: Q9Y3E5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKL
• Gene Sequence: KSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKL
• Gene ID - Mouse: ENSMUSG00000072582
• Gene ID - Rat: ENSRNOG00000004288
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PTRH2 pAb (ATL-HPA012897) – 3 Found

Karmali, Priya Prakash; Brunquell, Chris; Tram, Hau; Ireland, Shubha Kale; Ruoslahti, Erkki; Biliran, Hector. Metastasis of tumor cells is enhanced by downregulation of Bit1. Plos One. 6(8):e23840. 

Brunquell, Chris; Biliran, Hector; Jennings, Scott; Ireland, Shubha Kale; Chen, Renwei; Ruoslahti, Erkki. TLE1 is an anoikis regulator and is downregulated by Bit1 in breast cancer cells. Molecular Cancer Research : Mcr. 2012;10(11):1482-95. 

Yao, Xin; Jennings, Scott; Ireland, Shubha Kale; Pham, Tri; Temple, Brandi; Davis, Mya; Chen, Renwei; Davenport, Ian; Biliran, Hector. The anoikis effector Bit1 displays tumor suppressive function in lung cancer cells. Plos One. 9(7):e101564.