Anti PTPRU pAb (ATL-HPA039832)

Atlas Antibodies

Catalog No.: ATL-HPA039832-25

Protein Description: protein tyrosine phosphatase, receptor type, U
Gene Name: PTPRU
Alternative Gene Name: FMI, hPTP-J, PCP-2, PTP, PTPRO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028909: 90%, ENSRNOG00000013515: 90%
Entrez Gene ID: 10076
Uniprot ID: Q92729
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TFEEASDPAVPCEYSQAQYDDFQWEQVRIHPGTRAPADLPHGSYLMVNTSQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDG
• Gene Sequence: TFEEASDPAVPCEYSQAQYDDFQWEQVRIHPGTRAPADLPHGSYLMVNTSQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDG
• Gene ID - Mouse: ENSMUSG00000028909
• Gene ID - Rat: ENSRNOG00000013515
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.