Anti PTPRF pAb (ATL-HPA012710)

Atlas Antibodies

Catalog No.: ATL-HPA012710-25

Protein Description: protein tyrosine phosphatase, receptor type, F
Gene Name: PTPRF
Alternative Gene Name: LAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033295: 90%, ENSRNOG00000019977: 92%
Entrez Gene ID: 5792
Uniprot ID: P10586
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WHPPKELPGELLGYRLQYCRADEARPNTIDFGKDDQHFTVTGLHKGTTYIFRLAAKNRAGLGEEFEKEIRTPEDLPSGFPQNLHVTGLTTSTTELAWDPPVLAERNGRIISYTVVFRDINSQQE
• Gene Sequence: WHPPKELPGELLGYRLQYCRADEARPNTIDFGKDDQHFTVTGLHKGTTYIFRLAAKNRAGLGEEFEKEIRTPEDLPSGFPQNLHVTGLTTSTTELAWDPPVLAERNGRIISYTVVFRDINSQQE
• Gene ID - Mouse: ENSMUSG00000033295
• Gene ID - Rat: ENSRNOG00000019977
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PTPRF pAb (ATL-HPA012710) – 1 Found

Jäger, Katharina; Larribère, Lionel; Wu, Huizi; Weiss, Christel; Gebhardt, Christoffer; Utikal, Jochen. Expression of Neural Crest Markers GLDC and ERRFI1 is Correlated with Melanoma Prognosis. Cancers. 2019;11(1)