Anti PTPRE pAb (ATL-HPA015870)

Atlas Antibodies

Catalog No.: ATL-HPA015870-25

Protein Description: protein tyrosine phosphatase, receptor type, E
Gene Name: PTPRE
Alternative Gene Name: PTPE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041836: 96%, ENSRNOG00000015717: 98%
Entrez Gene ID: 5791
Uniprot ID: P23469
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NGILEEQEQQRVMLLSRSPSGPKKYFPIPVEHLEEEIRIRSADDCKQFREEFNSLPSGHIQGTFELANKEENREKNRYPNILPNDHSRVILSQLDGIPCSDYINASYIDGYKEKNKFIAAQGPKQE
• Gene Sequence: NGILEEQEQQRVMLLSRSPSGPKKYFPIPVEHLEEEIRIRSADDCKQFREEFNSLPSGHIQGTFELANKEENREKNRYPNILPNDHSRVILSQLDGIPCSDYINASYIDGYKEKNKFIAAQGPKQE
• Gene ID - Mouse: ENSMUSG00000041836
• Gene ID - Rat: ENSRNOG00000015717
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.