Anti PTPN1 pAb (ATL-HPA012542 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA012542-25

Protein Description: protein tyrosine phosphatase, non-receptor type 1
Gene Name: PTPN1
Alternative Gene Name: PTP1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027540: 64%, ENSRNOG00000010574: 67%
Entrez Gene ID: 5770
Uniprot ID: P18031
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYW
• Gene Sequence: RFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYW
• Gene ID - Mouse: ENSMUSG00000027540
• Gene ID - Rat: ENSRNOG00000010574
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PTPN1 pAb (ATL-HPA012542 w/enhanced validation) – 3 Found

Mishra, Ajay; Oulès, Bénédicte; Pisco, Angela Oliveira; Ly, Tony; Liakath-Ali, Kifayathullah; Walko, Gernot; Viswanathan, Priyalakshmi; Tihy, Matthieu; Nijjher, Jagdeesh; Dunn, Sara-Jane; Lamond, Angus I; Watt, Fiona M. A protein phosphatase network controls the temporal and spatial dynamics of differentiation commitment in human epidermis. Elife. 2017;6( 29043977) 

Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. 

Bai, Kun-Hao; Zhu, Ming-Jiao; Zhang, Yi-Yang; Li, Xue-Ping; Chen, Si-Liang; Wang, Da-Wei; Dai, Yu-Jun. Multi-omics analyses of tumor-associated immune-infiltrating cells with the novel immune checkpoint protein tyrosine phosphatase 1B (PTP1B) in extracellular matrix of brain-lower-grade-glioma (LGG) and uveal-melanoma (UVM). Frontiers In Immunology. 13( 36618415):1053856.