Anti PTPMT1 pAb (ATL-HPA043932)

Atlas Antibodies

Catalog No.: ATL-HPA043932-25

Protein Description: protein tyrosine phosphatase, mitochondrial 1
Gene Name: PTPMT1
Alternative Gene Name: DUSP23, MOSP, PLIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110860: 85%, ENSRNOG00000009723: 83%
Entrez Gene ID: 114971
Uniprot ID: Q8WUK0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARAT
• Gene Sequence: IPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARAT
• Gene ID - Mouse: ENSMUSG00000110860
• Gene ID - Rat: ENSRNOG00000009723
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PTPMT1 pAb (ATL-HPA043932) – 2 Found

Wolf, Dane M; Segawa, Mayuko; Kondadi, Arun Kumar; Anand, Ruchika; Bailey, Sean T; Reichert, Andreas S; van der Bliek, Alexander M; Shackelford, David B; Liesa, Marc; Shirihai, Orian S. Individual cristae within the same mitochondrion display different membrane potentials and are functionally independent. The Embo Journal. 2019;38(22):e101056. 

Corrado, Mauro; Edwards-Hicks, Joy; Villa, Matteo; Flachsmann, Lea J; Sanin, David E; Jacobs, Maaike; Baixauli, Francesc; Stanczak, Michal; Anderson, Eve; Azuma, Mai; Quintana, Andrea; Curtis, Jonathan D; Clapes, Thomas; Grzes, Katarzyna M; Kabat, Agnieszka M; Kyle, Ryan; Patterson, Annette E; Geltink, Ramon Klein; Amulic, Borko; Steward, Colin G; Strathdee, Douglas; Trompouki, Eirini; O'Sullivan, David; Pearce, Edward J; Pearce, Erika L. Dynamic Cardiolipin Synthesis Is Required for CD8(+) T Cell Immunity. Cell Metabolism. 2020;32(6):981-995.e7.