Anti PTGER3 pAb (ATL-HPA010689)

Atlas Antibodies

Catalog No.: ATL-HPA010689-25

Protein Description: prostaglandin E receptor 3 (subtype EP3)
Gene Name: PTGER3
Alternative Gene Name: EP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069601: 33%, ENSRNOG00000053288: 31%
Entrez Gene ID: 5733
Uniprot ID: P43115
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVS
• Gene Sequence: MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVS
• Gene ID - Mouse: ENSMUSG00000069601
• Gene ID - Rat: ENSRNOG00000053288
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PTGER3 pAb (ATL-HPA010689) – 1 Found

Oll, Matthias; Baumann, Claudia; Behbahani, Turang E; von Ruecker, Alexander; Müller, Stefan C; Ellinger, Jörg. Identification of prostaglandin receptors in human ureters. Bmc Urology. 2012;12( 23227994):35.