Anti PTGDS pAb (ATL-HPA004938)

Atlas Antibodies

Catalog No.: ATL-HPA004938-25

Protein Description: prostaglandin D2 synthase 21kDa (brain)
Gene Name: PTGDS
Alternative Gene Name: L-PGDS, PGDS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015090: 76%, ENSRNOG00000015550: 74%
Entrez Gene ID: 5730
Uniprot ID: P41222
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SWLREKKAALSMCKSVVAPATDGGLNLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSVVETDYDQYALLYSQGSKGPGEDFRMATLYSRTQT
• Gene Sequence: SWLREKKAALSMCKSVVAPATDGGLNLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSVVETDYDQYALLYSQGSKGPGEDFRMATLYSRTQT
• Gene ID - Mouse: ENSMUSG00000015090
• Gene ID - Rat: ENSRNOG00000015550
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PTGDS pAb (ATL-HPA004938) – 2 Found

Lind, Anne-Li; Just, David; Mikus, Maria; Fredolini, Claudia; Ioannou, Marina; Gerdle, Björn; Ghafouri, Bijar; Bäckryd, Emmanuel; Tanum, Lars; Gordh, Torsten; Månberg, Anna. CSF levels of apolipoprotein C1 and autotaxin found to associate with neuropathic pain and fibromyalgia. Journal Of Pain Research. 12( 31686904):2875-2889. 

Sala, Margaux; Gonzales, Delphine; Leste-Lasserre, Thierry; Dugot-Senant, Nathalie; Paradis, Valérie; Di Tommaso, Sylvaine; Dupuy, Jean-William; Pitard, Vincent; Dourthe, Cyril; Sciarra, Amedeo; Sempoux, Christine; Ferrell, Linda D; Clouston, Andrew D; Miller, Gregory; Yeh, Mathew M; Thung, Swan; Gouw, Annette S H; Quaglia, Alberto; Han, Jing; Huan, Ji; Fan, Cathy; Crawford, James; Nakanuma, Yasuni; Harada, Kenichi; le Bail, Brigitte; Castain, Claire; Frulio, Nora; Trillaud, Hervé; Possenti, Laurent; Blanc, Jean-Frédéric; Chiche, Laurence; Laurent, Christophe; Balabaud, Charles; Bioulac-Sage, Paulette; Raymond, Anne Aurélie; Saltel, Frédéric. ASS1 Overexpression: A Hallmark of Sonic Hedgehog Hepatocellular Adenomas; Recommendations for Clinical Practice. Hepatology Communications. 2020;4(6):809-824.