Anti PTER pAb (ATL-HPA038044)

Atlas Antibodies

Catalog No.:
ATL-HPA038044-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: phosphotriesterase related
Gene Name: PTER
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026730: 83%, ENSRNOG00000017328: 81%
Entrez Gene ID: 9317
Uniprot ID: Q96BW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTLTHEHLAMTFDCCYCPPPPCQEAISKEPIVMKNLYWIQKNAYSHKENLQLNQETEAIKEELLYFKANGGGALVENTTTG
Gene Sequence RTLTHEHLAMTFDCCYCPPPPCQEAISKEPIVMKNLYWIQKNAYSHKENLQLNQETEAIKEELLYFKANGGGALVENTTTG
Gene ID - Mouse ENSMUSG00000026730
Gene ID - Rat ENSRNOG00000017328
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PTER pAb (ATL-HPA038044)
Datasheet Anti PTER pAb (ATL-HPA038044) Datasheet (External Link)
Vendor Page Anti PTER pAb (ATL-HPA038044) at Atlas Antibodies

Documents & Links for Anti PTER pAb (ATL-HPA038044)
Datasheet Anti PTER pAb (ATL-HPA038044) Datasheet (External Link)
Vendor Page Anti PTER pAb (ATL-HPA038044)