Anti PTDSS2 pAb (ATL-HPA038929)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038929-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PTDSS2
Alternative Gene Name: PSS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025495: 55%, ENSRNOG00000015912: 49%
Entrez Gene ID: 81490
Uniprot ID: Q9BVG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DITLRYKETRWQKWQNKDDQGSTVGNGDQHPLGLDEDLLGPGVAEGEGAPTPN |
| Gene Sequence | DITLRYKETRWQKWQNKDDQGSTVGNGDQHPLGLDEDLLGPGVAEGEGAPTPN |
| Gene ID - Mouse | ENSMUSG00000025495 |
| Gene ID - Rat | ENSRNOG00000015912 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PTDSS2 pAb (ATL-HPA038929) | |
| Datasheet | Anti PTDSS2 pAb (ATL-HPA038929) Datasheet (External Link) |
| Vendor Page | Anti PTDSS2 pAb (ATL-HPA038929) at Atlas Antibodies |
| Documents & Links for Anti PTDSS2 pAb (ATL-HPA038929) | |
| Datasheet | Anti PTDSS2 pAb (ATL-HPA038929) Datasheet (External Link) |
| Vendor Page | Anti PTDSS2 pAb (ATL-HPA038929) |