Anti PTDSS2 pAb (ATL-HPA038928)

Atlas Antibodies

Catalog No.:
ATL-HPA038928-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: phosphatidylserine synthase 2
Gene Name: PTDSS2
Alternative Gene Name: PSS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025495: 94%, ENSRNOG00000015912: 92%
Entrez Gene ID: 81490
Uniprot ID: Q9BVG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QTVQDGRQFLKYVDPKLGVPLPERDYGGNCLIYDPDNETDPFHNIWDKLDGF
Gene Sequence QTVQDGRQFLKYVDPKLGVPLPERDYGGNCLIYDPDNETDPFHNIWDKLDGF
Gene ID - Mouse ENSMUSG00000025495
Gene ID - Rat ENSRNOG00000015912
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PTDSS2 pAb (ATL-HPA038928)
Datasheet Anti PTDSS2 pAb (ATL-HPA038928) Datasheet (External Link)
Vendor Page Anti PTDSS2 pAb (ATL-HPA038928) at Atlas Antibodies

Documents & Links for Anti PTDSS2 pAb (ATL-HPA038928)
Datasheet Anti PTDSS2 pAb (ATL-HPA038928) Datasheet (External Link)
Vendor Page Anti PTDSS2 pAb (ATL-HPA038928)