Anti PSPH pAb (ATL-HPA020376 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA020376-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PSPH
Alternative Gene Name: PSP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029446: 92%, ENSRNOG00000000925: 93%
Entrez Gene ID: 5723
Uniprot ID: P78330
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISG |
| Gene Sequence | AVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISG |
| Gene ID - Mouse | ENSMUSG00000029446 |
| Gene ID - Rat | ENSRNOG00000000925 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PSPH pAb (ATL-HPA020376 w/enhanced validation) | |
| Datasheet | Anti PSPH pAb (ATL-HPA020376 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PSPH pAb (ATL-HPA020376 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PSPH pAb (ATL-HPA020376 w/enhanced validation) | |
| Datasheet | Anti PSPH pAb (ATL-HPA020376 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PSPH pAb (ATL-HPA020376 w/enhanced validation) |
| Citations for Anti PSPH pAb (ATL-HPA020376 w/enhanced validation) – 7 Found |
| Krall, Abigail S; Xu, Shili; Graeber, Thomas G; Braas, Daniel; Christofk, Heather R. Asparagine promotes cancer cell proliferation through use as an amino acid exchange factor. Nature Communications. 2016;7( 27126896):11457. PubMed |
| Kitazawa, Satoshi; Ebara, Shunsuke; Ando, Ayumi; Baba, Yuji; Satomi, Yoshinori; Soga, Tomoyoshi; Hara, Takahito. Succinate dehydrogenase B-deficient cancer cells are highly sensitive to bromodomain and extra-terminal inhibitors. Oncotarget. 2017;8(17):28922-28938. PubMed |
| Rinaldi, Gianmarco; Pranzini, Erica; Van Elsen, Joke; Broekaert, Dorien; Funk, Cornelius M; Planque, Mélanie; Doglioni, Ginevra; Altea-Manzano, Patricia; Rossi, Matteo; Geldhof, Vincent; Teoh, Shao Thing; Ross, Christina; Hunter, Kent W; Lunt, Sophia Y; Grünewald, Thomas G P; Fendt, Sarah-Maria. In Vivo Evidence for Serine Biosynthesis-Defined Sensitivity of Lung Metastasis, but Not of Primary Breast Tumors, to mTORC1 Inhibition. Molecular Cell. 2021;81(2):386-397.e7. PubMed |
| Possemato, Richard; Marks, Kevin M; Shaul, Yoav D; Pacold, Michael E; Kim, Dohoon; Birsoy, Kıvanç; Sethumadhavan, Shalini; Woo, Hin-Koon; Jang, Hyun G; Jha, Abhishek K; Chen, Walter W; Barrett, Francesca G; Stransky, Nicolas; Tsun, Zhi-Yang; Cowley, Glenn S; Barretina, Jordi; Kalaany, Nada Y; Hsu, Peggy P; Ottina, Kathleen; Chan, Albert M; Yuan, Bingbing; Garraway, Levi A; Root, David E; Mino-Kenudson, Mari; Brachtel, Elena F; Driggers, Edward M; Sabatini, David M. Functional genomics reveal that the serine synthesis pathway is essential in breast cancer. Nature. 2011;476(7360):346-50. PubMed |
| Cai, Fei-Fei; Song, Ya-Nan; Lu, Yi-Yu; Zhang, Yongyu; Hu, Yi-Yang; Su, Shi-Bing. Analysis of plasma metabolic profile, characteristics and enzymes in the progression from chronic hepatitis B to hepatocellular carcinoma. Aging. 2020;12(14):14949-14965. PubMed |
| Kiweler, Nicole; Delbrouck, Catherine; Pozdeev, Vitaly I; Neises, Laura; Soriano-Baguet, Leticia; Eiden, Kim; Xian, Feng; Benzarti, Mohaned; Haase, Lara; Koncina, Eric; Schmoetten, Maryse; Jaeger, Christian; Noman, Muhammad Zaeem; Vazquez, Alexei; Janji, Bassam; Dittmar, Gunnar; Brenner, Dirk; Letellier, Elisabeth; Meiser, Johannes. Mitochondria preserve an autarkic one-carbon cycle to confer growth-independent cancer cell migration and metastasis. Nature Communications. 2022;13(1):2699. PubMed |
| Van Nyen, Tom; Planque, Mélanie; van Wagensveld, Lilian; Duarte, Joao A G; Zaal, Esther A; Talebi, Ali; Rossi, Matteo; Körner, Pierre-René; Rizzotto, Lara; Moens, Stijn; De Wispelaere, Wout; Baiden-Amissah, Regina E M; Sonke, Gabe S; Horlings, Hugo M; Eelen, Guy; Berardi, Emanuele; Swinnen, Johannes V; Berkers, Celia R; Carmeliet, Peter; Lambrechts, Diether; Davidson, Ben; Agami, Reuven; Fendt, Sarah-Maria; Annibali, Daniela; Amant, Frédéric. Serine metabolism remodeling after platinum-based chemotherapy identifies vulnerabilities in a subgroup of resistant ovarian cancers. Nature Communications. 2022;13(1):4578. PubMed |