Anti PSMF1 pAb (ATL-HPA041122 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041122-25

Protein Description: proteasome (prosome, macropain) inhibitor subunit 1 (PI31)
Gene Name: PSMF1
Alternative Gene Name: PI31
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032869: 82%, ENSRNOG00000009640: 82%
Entrez Gene ID: 9491
Uniprot ID: Q92530
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSMILNVLEYGSQQVADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIITPIHEQWEKANVSSP
• Gene Sequence: SSMILNVLEYGSQQVADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIITPIHEQWEKANVSSP
• Gene ID - Mouse: ENSMUSG00000032869
• Gene ID - Rat: ENSRNOG00000009640
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PSMF1 pAb (ATL-HPA041122 w/enhanced validation) – 1 Found

Corridoni, Daniele; Shiraishi, Seiji; Chapman, Thomas; Steevels, Tessa; Muraro, Daniele; Thézénas, Marie-Laëtitia; Prota, Gennaro; Chen, Ji-Li; Gileadi, Uzi; Ternette, Nicola; Cerundolo, Vincenzo; Simmons, Alison. NOD2 and TLR2 Signal via TBK1 and PI31 to Direct Cross-Presentation and CD8 T Cell Responses. Frontiers In Immunology. 10( 31114588):958.