Anti PSME1 pAb (ATL-HPA006632)

Atlas Antibodies

Catalog No.: ATL-HPA006632-25

Protein Description: proteasome (prosome, macropain) activator subunit 1 (PA28 alpha)
Gene Name: PSME1
Alternative Gene Name: IFI5111, PA28alpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022216: 96%, ENSRNOG00000019041: 96%
Entrez Gene ID: 5720
Uniprot ID: Q06323
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY
• Gene Sequence: AVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY
• Gene ID - Mouse: ENSMUSG00000022216
• Gene ID - Rat: ENSRNOG00000019041
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PSME1 pAb (ATL-HPA006632) – 1 Found

Kamper, Peter; Ludvigsen, Maja; Bendix, Knud; Hamilton-Dutoit, Stephen; Rabinovich, Gabriel A; Møller, Michael Boe; Nyengaard, Jens R; Honoré, Bent; d'Amore, Francesco. Proteomic analysis identifies galectin-1 as a predictive biomarker for relapsed/refractory disease in classical Hodgkin lymphoma. Blood. 2011;117(24):6638-49.