Anti PSMC4 pAb (ATL-HPA002044)

Atlas Antibodies

Catalog No.: ATL-HPA002044-25

Protein Description: proteasome (prosome, macropain) 26S subunit, ATPase, 4
Gene Name: PSMC4
Alternative Gene Name: MGC13687, MGC23214, MGC8570, MIP224, S6, TBP-7, TBP7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030603: 100%, ENSRNOG00000018994: 100%
Entrez Gene ID: 5704
Uniprot ID: P43686
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNA
• Gene Sequence: LEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNA
• Gene ID - Mouse: ENSMUSG00000030603
• Gene ID - Rat: ENSRNOG00000018994
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PSMC4 pAb (ATL-HPA002044) – 1 Found

Chen, Yunhao; Choong, Lee-Yee; Lin, Qingsong; Philp, Robin; Wong, Chee-Hong; Ang, Boon-Keong; Tan, Yee-Ling; Loh, Marie-Chiew-Shia; Hew, Choy-Leong; Shah, Nilesh; Druker, Brian J; Chong, Poh-Kuan; Lim, Yoon-Pin. Differential expression of novel tyrosine kinase substrates during breast cancer development. Molecular & Cellular Proteomics : Mcp. 2007;6(12):2072-87.