Anti PSMC1 pAb (ATL-HPA000872)

Atlas Antibodies

Catalog No.: ATL-HPA000872-25

Protein Description: proteasome (prosome, macropain) 26S subunit, ATPase, 1
Gene Name: PSMC1
Alternative Gene Name: p56, S4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021178: 100%, ENSRNOG00000003951: 100%
Entrez Gene ID: 5700
Uniprot ID: P62191
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPE
• Gene Sequence: YDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPE
• Gene ID - Mouse: ENSMUSG00000021178
• Gene ID - Rat: ENSRNOG00000003951
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PSMC1 pAb (ATL-HPA000872) – 3 Found

Thinon, Emmanuelle; Serwa, Remigiusz A; Broncel, Malgorzata; Brannigan, James A; Brassat, Ute; Wright, Megan H; Heal, William P; Wilkinson, Anthony J; Mann, David J; Tate, Edward W. Global profiling of co- and post-translationally N-myristoylated proteomes in human cells. Nature Communications. 2014;5( 25255805):4919. 

Czub, Barbara; Shah, Amna Z; Alfano, Giovanna; Kruczek, Przemysław M; Chakarova, Christina F; Bhattacharya, Shomi S. TOPORS, a Dual E3 Ubiquitin and Sumo1 Ligase, Interacts with 26 S Protease Regulatory Subunit 4, Encoded by the PSMC1 Gene. Plos One. 11(2):e0148678. 

Ma, Tian-Ze; Piao, Zhe; Jin, Sheng-Yu; Kwak, Yong-Geun. Differential expression of serum proteins in multiple myeloma. Experimental And Therapeutic Medicine. 2019;17(1):649-656.