Anti PSMB3 pAb (ATL-HPA042775)

Atlas Antibodies

Catalog No.: ATL-HPA042775-25

Protein Description: proteasome (prosome, macropain) subunit, beta type, 3
Gene Name: PSMB3
Alternative Gene Name: HC10-II, MGC4147
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069744: 98%, ENSRNOG00000052730: 98%
Entrez Gene ID: 5691
Uniprot ID: P49720
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRD
• Gene Sequence: LYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRD
• Gene ID - Mouse: ENSMUSG00000069744
• Gene ID - Rat: ENSRNOG00000052730
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PSMB3 pAb (ATL-HPA042775) – 1 Found

Kobatake, Kohei; Ikeda, Kenichiro; Teishima, Jun; Sekino, Yohei; Babasaki, Takashi; Kohada, Yuki; Tasaka, Ryo; Takemoto, Kenshiro; Fukushima, Takafumi; Miyamoto, Shunsuke; Kitano, Hiroyuki; Goto, Keisuke; Hieda, Keisuke; Hayashi, Tetsutaro; Hinata, Nobuyuki. Complexity in radiological morphology predicts worse prognosis and is associated with an increase in proteasome component levels in clear cell renal cell carcinoma. Frontiers In Oncology. 12( 36568232):1039383.