Anti PSMB2 pAb (ATL-HPA026324)

Atlas Antibodies

Catalog No.: ATL-HPA026324-25

Protein Description: proteasome (prosome, macropain) subunit, beta type, 2
Gene Name: PSMB2
Alternative Gene Name: HC7-I
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028837: 100%, ENSRNOG00000011463: 100%
Entrez Gene ID: 5690
Uniprot ID: P49721
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTP
• Gene Sequence: YVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTP
• Gene ID - Mouse: ENSMUSG00000028837
• Gene ID - Rat: ENSRNOG00000011463
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.