Anti PSD4 pAb (ATL-HPA034722 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA034722-25

Protein Description: pleckstrin and Sec7 domain containing 4
Gene Name: PSD4
Alternative Gene Name: EFA6B, TIC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026979: 56%, ENSRNOG00000006079: 55%
Entrez Gene ID: 23550
Uniprot ID: Q8NDX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EESMFFSNPLFLASPCSENSASGECFSWGASDSHAGVRTGPESPATLEPPLPEDTVLWELESEPDLGDGAAISGHCTPPFPVPIYKPHSI
• Gene Sequence: EESMFFSNPLFLASPCSENSASGECFSWGASDSHAGVRTGPESPATLEPPLPEDTVLWELESEPDLGDGAAISGHCTPPFPVPIYKPHSI
• Gene ID - Mouse: ENSMUSG00000026979
• Gene ID - Rat: ENSRNOG00000006079
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PSD4 pAb (ATL-HPA034722 w/enhanced validation) – 2 Found

Hashimoto, Shigeru; Mikami, Shuji; Sugino, Hirokazu; Yoshikawa, Ayumu; Hashimoto, Ari; Onodera, Yasuhito; Furukawa, Shotaro; Handa, Haruka; Oikawa, Tsukasa; Okada, Yasunori; Oya, Mototsugu; Sabe, Hisataka. Lysophosphatidic acid activates Arf6 to promote the mesenchymal malignancy of renal cancer. Nature Communications. 2016;7( 26854204):10656. 

Zobel, Martina; Disanza, Andrea; Senic-Matuglia, Francesca; Franco, Michel; Colaluca, Ivan Nicola; Confalonieri, Stefano; Bisi, Sara; Barbieri, Elisa; Caldieri, Giusi; Sigismund, Sara; Pece, Salvatore; Chavrier, Philippe; Di Fiore, Pier Paolo; Scita, Giorgio. A NUMB-EFA6B-ARF6 recycling route controls apically restricted cell protrusions and mesenchymal motility. The Journal Of Cell Biology. 2018;217(9):3161-3182.