Anti PSAT1 pAb (ATL-HPA042924)

Atlas Antibodies

Catalog No.: ATL-HPA042924-25

Protein Description: phosphoserine aminotransferase 1
Gene Name: PSAT1
Alternative Gene Name: PSA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024640: 96%, ENSRNOG00000013971: 97%
Entrez Gene ID: 29968
Uniprot ID: Q9Y617
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAG
• Gene Sequence: GAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAG
• Gene ID - Mouse: ENSMUSG00000024640
• Gene ID - Rat: ENSRNOG00000013971
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PSAT1 pAb (ATL-HPA042924) – 1 Found

Kiweler, Nicole; Delbrouck, Catherine; Pozdeev, Vitaly I; Neises, Laura; Soriano-Baguet, Leticia; Eiden, Kim; Xian, Feng; Benzarti, Mohaned; Haase, Lara; Koncina, Eric; Schmoetten, Maryse; Jaeger, Christian; Noman, Muhammad Zaeem; Vazquez, Alexei; Janji, Bassam; Dittmar, Gunnar; Brenner, Dirk; Letellier, Elisabeth; Meiser, Johannes. Mitochondria preserve an autarkic one-carbon cycle to confer growth-independent cancer cell migration and metastasis. Nature Communications. 2022;13(1):2699.