Anti PRSS8 pAb (ATL-HPA030436)

Atlas Antibodies

Catalog No.:
ATL-HPA030436-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: protease, serine, 8
Gene Name: PRSS8
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030800: 87%, ENSRNOG00000019616: 87%
Entrez Gene ID: 5652
Uniprot ID: Q16651
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYV
Gene Sequence RPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYV
Gene ID - Mouse ENSMUSG00000030800
Gene ID - Rat ENSRNOG00000019616
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRSS8 pAb (ATL-HPA030436)
Datasheet Anti PRSS8 pAb (ATL-HPA030436) Datasheet (External Link)
Vendor Page Anti PRSS8 pAb (ATL-HPA030436) at Atlas Antibodies

Documents & Links for Anti PRSS8 pAb (ATL-HPA030436)
Datasheet Anti PRSS8 pAb (ATL-HPA030436) Datasheet (External Link)
Vendor Page Anti PRSS8 pAb (ATL-HPA030436)