Anti PRSS53 pAb (ATL-HPA034956)

Atlas Antibodies

Catalog No.:
ATL-HPA034956-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: protease, serine, 53
Gene Name: PRSS53
Alternative Gene Name: POL3S
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044139: 81%, ENSRNOG00000032429: 34%
Entrez Gene ID: 339105
Uniprot ID: Q2L4Q9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELPSCEGLSGAPLVHEVRGTWFLAGLHSFGDACQGPARPAVFTALPAYEDWVSSLDWQVYFAEEPEPEAEPGSCLANISQPTS
Gene Sequence ELPSCEGLSGAPLVHEVRGTWFLAGLHSFGDACQGPARPAVFTALPAYEDWVSSLDWQVYFAEEPEPEAEPGSCLANISQPTS
Gene ID - Mouse ENSMUSG00000044139
Gene ID - Rat ENSRNOG00000032429
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRSS53 pAb (ATL-HPA034956)
Datasheet Anti PRSS53 pAb (ATL-HPA034956) Datasheet (External Link)
Vendor Page Anti PRSS53 pAb (ATL-HPA034956) at Atlas Antibodies

Documents & Links for Anti PRSS53 pAb (ATL-HPA034956)
Datasheet Anti PRSS53 pAb (ATL-HPA034956) Datasheet (External Link)
Vendor Page Anti PRSS53 pAb (ATL-HPA034956)