Anti PRSS53 pAb (ATL-HPA034955)
Atlas Antibodies
- Catalog No.:
- ATL-HPA034955-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PRSS53
Alternative Gene Name: POL3S
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044139: 82%, ENSRNOG00000026040: 81%
Entrez Gene ID: 339105
Uniprot ID: Q2L4Q9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PTTHTPLCLPQPAHRFPFGASCWATGWDQDTSDAPGTLRNLRLRLISRPTCNCIYNQLHQRHLSNPARPGMLCG |
| Gene Sequence | PTTHTPLCLPQPAHRFPFGASCWATGWDQDTSDAPGTLRNLRLRLISRPTCNCIYNQLHQRHLSNPARPGMLCG |
| Gene ID - Mouse | ENSMUSG00000044139 |
| Gene ID - Rat | ENSRNOG00000026040 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRSS53 pAb (ATL-HPA034955) | |
| Datasheet | Anti PRSS53 pAb (ATL-HPA034955) Datasheet (External Link) |
| Vendor Page | Anti PRSS53 pAb (ATL-HPA034955) at Atlas Antibodies |
| Documents & Links for Anti PRSS53 pAb (ATL-HPA034955) | |
| Datasheet | Anti PRSS53 pAb (ATL-HPA034955) Datasheet (External Link) |
| Vendor Page | Anti PRSS53 pAb (ATL-HPA034955) |