Anti PRSS50 pAb (ATL-HPA040768)

Atlas Antibodies

Catalog No.:
ATL-HPA040768-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: protease, serine 50
Gene Name: PRSS50
Alternative Gene Name: CT20, TSP50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048752: 65%, ENSRNOG00000037175: 63%
Entrez Gene ID:
Uniprot ID: Q9UI38
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLSKADGMWPQFRTIQEKEVIILNNKECDNFYHNFTKIPTLVQIIKSQMMCAEDTHREKFCYELTGEPLVCSMEGTWYL
Gene Sequence GLSKADGMWPQFRTIQEKEVIILNNKECDNFYHNFTKIPTLVQIIKSQMMCAEDTHREKFCYELTGEPLVCSMEGTWYL
Gene ID - Mouse ENSMUSG00000048752
Gene ID - Rat ENSRNOG00000037175
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRSS50 pAb (ATL-HPA040768)
Datasheet Anti PRSS50 pAb (ATL-HPA040768) Datasheet (External Link)
Vendor Page Anti PRSS50 pAb (ATL-HPA040768) at Atlas Antibodies

Documents & Links for Anti PRSS50 pAb (ATL-HPA040768)
Datasheet Anti PRSS50 pAb (ATL-HPA040768) Datasheet (External Link)
Vendor Page Anti PRSS50 pAb (ATL-HPA040768)