Anti PRSS36 pAb (ATL-HPA036079)

Atlas Antibodies

Catalog No.: ATL-HPA036079-25

Protein Description: protease, serine, 36
Gene Name: PRSS36
Alternative Gene Name: FLJ90661
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070371: 79%, ENSRNOG00000033343: 78%
Entrez Gene ID: 146547
Uniprot ID: Q5K4E3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WVLGWKEPQDRVPVAAAVSILTQRICDCLYQGILPPGTLCVLYAEGQENRCEMTSAPPLLCQMTEGSWIPVGMAVQGSRELFAAIG
• Gene Sequence: WVLGWKEPQDRVPVAAAVSILTQRICDCLYQGILPPGTLCVLYAEGQENRCEMTSAPPLLCQMTEGSWIPVGMAVQGSRELFAAIG
• Gene ID - Mouse: ENSMUSG00000070371
• Gene ID - Rat: ENSRNOG00000033343
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PRSS36 pAb (ATL-HPA036079) – 1 Found

Basu, Abhijit; Munir, Saira; Mulaw, Medanie A; Singh, Karmveer; Crisan, Diana; Sindrilaru, Anca; Treiber, Nicolai; Wlaschek, Meinhard; Huber-Lang, Markus; Gebhard, Florian; Scharffetter-Kochanek, Karin. A Novel S100A8/A9 Induced Fingerprint of Mesenchymal Stem Cells associated with Enhanced Wound Healing. Scientific Reports. 2018;8(1):6205.