Anti PRSS12 pAb (ATL-HPA035055)

Atlas Antibodies

Catalog No.: ATL-HPA035055-25

Protein Description: protease, serine, 12 (neurotrypsin, motopsin)
Gene Name: PRSS12
Alternative Gene Name: BSSP-3, MRT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027978: 71%, ENSRNOG00000015353: 72%
Entrez Gene ID: 8492
Uniprot ID: P56730
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WVSVTDFGAPCLRWAEVPPFLERSPPASWAQLRGQRHNFCRSPDGAGRPWCFYGDARGKVDWGYCDCRHGSVRLRGGK
• Gene Sequence: WVSVTDFGAPCLRWAEVPPFLERSPPASWAQLRGQRHNFCRSPDGAGRPWCFYGDARGKVDWGYCDCRHGSVRLRGGK
• Gene ID - Mouse: ENSMUSG00000027978
• Gene ID - Rat: ENSRNOG00000015353
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.