Anti PRR15L pAb (ATL-HPA022918)

Atlas Antibodies

Catalog No.: ATL-HPA022918-25

Protein Description: proline rich 15-like
Gene Name: PRR15L
Alternative Gene Name: ATAD4, MGC11242
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047040: 91%, ENSRNOG00000049162: 88%
Entrez Gene ID: 79170
Uniprot ID: Q9BU68
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EIGWWKLTFLRKKKSTPKVLYEIPDTYAQTEGDAEPPRPDAGGPNSDFNTRLEKIVDKSTKGKHVKVSNSGRFKEKKKVRATLAENPNLFD
• Gene Sequence: EIGWWKLTFLRKKKSTPKVLYEIPDTYAQTEGDAEPPRPDAGGPNSDFNTRLEKIVDKSTKGKHVKVSNSGRFKEKKKVRATLAENPNLFD
• Gene ID - Mouse: ENSMUSG00000047040
• Gene ID - Rat: ENSRNOG00000049162
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.