Anti PRR12 pAb (ATL-HPA011959)

Atlas Antibodies

Catalog No.:
ATL-HPA011959-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: proline rich 12
Gene Name: PRR12
Alternative Gene Name: KIAA1205
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046574: 94%, ENSRNOG00000059408: 91%
Entrez Gene ID: 57479
Uniprot ID: Q9ULL5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TKVKAEPPPKKRKKWLKEAGGNATAGGGPPGSSSDSESSPGAPSEDERAVPGRLLKTRAMREMYRSYVEMLVSTALDPD
Gene Sequence TKVKAEPPPKKRKKWLKEAGGNATAGGGPPGSSSDSESSPGAPSEDERAVPGRLLKTRAMREMYRSYVEMLVSTALDPD
Gene ID - Mouse ENSMUSG00000046574
Gene ID - Rat ENSRNOG00000059408
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRR12 pAb (ATL-HPA011959)
Datasheet Anti PRR12 pAb (ATL-HPA011959) Datasheet (External Link)
Vendor Page Anti PRR12 pAb (ATL-HPA011959) at Atlas Antibodies

Documents & Links for Anti PRR12 pAb (ATL-HPA011959)
Datasheet Anti PRR12 pAb (ATL-HPA011959) Datasheet (External Link)
Vendor Page Anti PRR12 pAb (ATL-HPA011959)