Anti PRR12 pAb (ATL-HPA011959)
Atlas Antibodies
- Catalog No.:
- ATL-HPA011959-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PRR12
Alternative Gene Name: KIAA1205
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046574: 94%, ENSRNOG00000059408: 91%
Entrez Gene ID: 57479
Uniprot ID: Q9ULL5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TKVKAEPPPKKRKKWLKEAGGNATAGGGPPGSSSDSESSPGAPSEDERAVPGRLLKTRAMREMYRSYVEMLVSTALDPD |
| Gene Sequence | TKVKAEPPPKKRKKWLKEAGGNATAGGGPPGSSSDSESSPGAPSEDERAVPGRLLKTRAMREMYRSYVEMLVSTALDPD |
| Gene ID - Mouse | ENSMUSG00000046574 |
| Gene ID - Rat | ENSRNOG00000059408 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRR12 pAb (ATL-HPA011959) | |
| Datasheet | Anti PRR12 pAb (ATL-HPA011959) Datasheet (External Link) |
| Vendor Page | Anti PRR12 pAb (ATL-HPA011959) at Atlas Antibodies |
| Documents & Links for Anti PRR12 pAb (ATL-HPA011959) | |
| Datasheet | Anti PRR12 pAb (ATL-HPA011959) Datasheet (External Link) |
| Vendor Page | Anti PRR12 pAb (ATL-HPA011959) |