Anti PRR11 pAb (ATL-HPA023923 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA023923-25

Protein Description: proline rich 11
Gene Name: PRR11
Alternative Gene Name: FLJ11029
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020493: 76%, ENSRNOG00000006198: 74%
Entrez Gene ID: 55771
Uniprot ID: Q96HE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LAPVLLRKPSLAKALQAGPLKKDGPMQITVKDLLTVKLKKTQSLDEKRKLIPSPKARNPLVTVSDLQHVTLKPNSKVLSTR
• Gene Sequence: LAPVLLRKPSLAKALQAGPLKKDGPMQITVKDLLTVKLKKTQSLDEKRKLIPSPKARNPLVTVSDLQHVTLKPNSKVLSTR
• Gene ID - Mouse: ENSMUSG00000020493
• Gene ID - Rat: ENSRNOG00000006198
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PRR11 pAb (ATL-HPA023923 w/enhanced validation) – 5 Found

Chen, Ying; Cha, Zhanshan; Fang, Wenzheng; Qian, Baohua; Yu, Wenlong; Li, Wenfeng; Yu, Guanzhen; Gao, Yong. The prognostic potential and oncogenic effects of PRR11 expression in hilar cholangiocarcinoma. Oncotarget. 2015;6(24):20419-33. 

Song, Zongchang; Liu, Wenying; Xiao, Yu; Zhang, Minghui; Luo, Yan; Yuan, Weiwei; Xu, Yu; Yu, Guanzhen; Hu, Yide. PRR11 Is a Prognostic Marker and Potential Oncogene in Patients with Gastric Cancer. Plos One. 10(8):e0128943. 

Cai, Chao; He, Huichan; Duan, Xiaolu; Wu, Wenqi; Mai, Zanlin; Zhang, Tao; Fan, Junhong; Deng, Tuo; Zhong, Wen; Liu, Yongda; Zhong, Weide; Zeng, Guohua. miR-195 inhibits cell proliferation and angiogenesis in human prostate cancer by downregulating PRR11 expression. Oncology Reports. 2018;39(4):1658-1670. 

Olsson Hau, Sofie; Wahlin, Sara; Cervin, Sophie; Falk, Vilgot; Nodin, Björn; Elebro, Jacob; Eberhard, Jakob; Moran, Bruce; Gallagher, William M; Karnevi, Emelie; Jirström, Karin. PRR11 unveiled as a top candidate biomarker within the RBM3-regulated transcriptome in pancreatic cancer. The Journal Of Pathology. Clinical Research. 2022;8(1):65-77. 

Zhan, Yu; Wu, Xueyuan; Zheng, Gang; Jin, Jingjing; Li, Chaofu; Yu, Guanzhen; Li, Wenfeng. Proline-rich protein 11 overexpression is associated with a more aggressive phenotype and poor overall survival in ovarian cancer patients. World Journal Of Surgical Oncology. 2020;18(1):318.