Anti PRPS1 pAb (ATL-HPA043760)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043760-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PRPS1
Alternative Gene Name: CMTX5, DFN2, DFNX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002100: 36%, ENSRNOG00000028627: 39%
Entrez Gene ID: 5631
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LHASQIQVSVEAKYWCLKGGRKGLMMLKTAEKP |
| Gene Sequence | LHASQIQVSVEAKYWCLKGGRKGLMMLKTAEKP |
| Gene ID - Mouse | ENSMUSG00000002100 |
| Gene ID - Rat | ENSRNOG00000028627 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRPS1 pAb (ATL-HPA043760) | |
| Datasheet | Anti PRPS1 pAb (ATL-HPA043760) Datasheet (External Link) |
| Vendor Page | Anti PRPS1 pAb (ATL-HPA043760) at Atlas Antibodies |
| Documents & Links for Anti PRPS1 pAb (ATL-HPA043760) | |
| Datasheet | Anti PRPS1 pAb (ATL-HPA043760) Datasheet (External Link) |
| Vendor Page | Anti PRPS1 pAb (ATL-HPA043760) |