Anti PRPS1 pAb (ATL-HPA043760)

Atlas Antibodies

Catalog No.:
ATL-HPA043760-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: phosphoribosyl pyrophosphate synthetase 1
Gene Name: PRPS1
Alternative Gene Name: CMTX5, DFN2, DFNX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002100: 36%, ENSRNOG00000028627: 39%
Entrez Gene ID: 5631
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LHASQIQVSVEAKYWCLKGGRKGLMMLKTAEKP
Gene Sequence LHASQIQVSVEAKYWCLKGGRKGLMMLKTAEKP
Gene ID - Mouse ENSMUSG00000002100
Gene ID - Rat ENSRNOG00000028627
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRPS1 pAb (ATL-HPA043760)
Datasheet Anti PRPS1 pAb (ATL-HPA043760) Datasheet (External Link)
Vendor Page Anti PRPS1 pAb (ATL-HPA043760) at Atlas Antibodies

Documents & Links for Anti PRPS1 pAb (ATL-HPA043760)
Datasheet Anti PRPS1 pAb (ATL-HPA043760) Datasheet (External Link)
Vendor Page Anti PRPS1 pAb (ATL-HPA043760)