Anti PRPF4B pAb (ATL-HPA020638)

Atlas Antibodies

Catalog No.: ATL-HPA020638-25

Protein Description: pre-mRNA processing factor 4B
Gene Name: PRPF4B
Alternative Gene Name: KIAA0536, PR4H, Prp4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021413: 97%, ENSRNOG00000016705: 97%
Entrez Gene ID: 8899
Uniprot ID: Q13523
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEDFDVEEEDEEALIEQRRIQRQAIVQKYKYLAEDSNMSVPSEPSSPQSSTRTRSPSPDDILERVAADVKEYERENVDTFEASVKAKHNLMTVEQNNGSSQKKLLAPDMF
• Gene Sequence: LEDFDVEEEDEEALIEQRRIQRQAIVQKYKYLAEDSNMSVPSEPSSPQSSTRTRSPSPDDILERVAADVKEYERENVDTFEASVKAKHNLMTVEQNNGSSQKKLLAPDMF
• Gene ID - Mouse: ENSMUSG00000021413
• Gene ID - Rat: ENSRNOG00000016705
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.