Anti PRPF4 pAb (ATL-HPA021794 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA021794-25

Protein Description: pre-mRNA processing factor 4
Gene Name: PRPF4
Alternative Gene Name: HPRP4, HPRP4P, PRP4, Prp4p, SNRNP60
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066148: 97%, ENSRNOG00000014777: 97%
Entrez Gene ID: 9128
Uniprot ID: O43172
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QATKTKAPDDLVAPVVKKPHIYYGSLEEKERERLAKGESGILGKDGLKAGIEAGNINITSGEVFEIEEHISERQAEVLAEFERRKRARQINVSTDDS
• Gene Sequence: QATKTKAPDDLVAPVVKKPHIYYGSLEEKERERLAKGESGILGKDGLKAGIEAGNINITSGEVFEIEEHISERQAEVLAEFERRKRARQINVSTDDS
• Gene ID - Mouse: ENSMUSG00000066148
• Gene ID - Rat: ENSRNOG00000014777
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.