Anti PRPF18 pAb (ATL-HPA037599)

Atlas Antibodies

Catalog No.:
ATL-HPA037599-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: pre-mRNA processing factor 18
Gene Name: PRPF18
Alternative Gene Name: hPrp18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039449: 100%, ENSRNOG00000018396: 99%
Entrez Gene ID: 8559
Uniprot ID: Q99633
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen SNPVLELELAEEKLPMTLSRQEVIRRLRERGEPIRLFGETDYDAFQRLRKIEILTPEVNKGLRNDLKAALDKIDQQYLNEIVG
Gene Sequence SNPVLELELAEEKLPMTLSRQEVIRRLRERGEPIRLFGETDYDAFQRLRKIEILTPEVNKGLRNDLKAALDKIDQQYLNEIVG
Gene ID - Mouse ENSMUSG00000039449
Gene ID - Rat ENSRNOG00000018396
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRPF18 pAb (ATL-HPA037599)
Datasheet Anti PRPF18 pAb (ATL-HPA037599) Datasheet (External Link)
Vendor Page Anti PRPF18 pAb (ATL-HPA037599) at Atlas Antibodies

Documents & Links for Anti PRPF18 pAb (ATL-HPA037599)
Datasheet Anti PRPF18 pAb (ATL-HPA037599) Datasheet (External Link)
Vendor Page Anti PRPF18 pAb (ATL-HPA037599)