Anti PROSER2 pAb (ATL-HPA041337)

Atlas Antibodies

Catalog No.: ATL-HPA041337-25

Protein Description: proline and serine rich 2
Gene Name: PROSER2
Alternative Gene Name: C10orf47, MGC35403
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045319: 74%, ENSRNOG00000045553: 69%
Entrez Gene ID: 254427
Uniprot ID: Q86WR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLLRSVPTPLVMAQKISERMAGNEALSPTSPFREGRPGEWRTPAARGPRSGDPG
• Gene Sequence: RLLRSVPTPLVMAQKISERMAGNEALSPTSPFREGRPGEWRTPAARGPRSGDPG
• Gene ID - Mouse: ENSMUSG00000045319
• Gene ID - Rat: ENSRNOG00000045553
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.