Anti PROSC pAb (ATL-HPA023733 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA023733-100

Protein Description: proline synthetase co-transcribed homolog (bacterial)
Gene Name: PROSC
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031485: 84%, ENSRNOG00000013751: 83%
Entrez Gene ID: 11212
Uniprot ID: O94903
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSQGPNPDFQLLLSLREELCKKLNIPADQVELSMGMSADFQHAVEVGSTNVRIGSTIFGERDYSKKPTP
• Gene Sequence: LSQGPNPDFQLLLSLREELCKKLNIPADQVELSMGMSADFQHAVEVGSTNVRIGSTIFGERDYSKKPTP
• Gene ID - Mouse: ENSMUSG00000031485
• Gene ID - Rat: ENSRNOG00000013751
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PROSC pAb (ATL-HPA023733 w/enhanced validation) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.