Anti PROSC pAb (ATL-HPA023646 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA023646-100

Protein Description: proline synthetase co-transcribed homolog (bacterial)
Gene Name: PROSC
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031485: 85%, ENSRNOG00000013751: 88%
Entrez Gene ID: 11212
Uniprot ID: O94903
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VPNLFMLETVDSVKLADKVNSSWQRKGSPERLKVMVQINTSGEESKHGLPPSETIAIVEHINAKCPNLEFVGLMT
• Gene Sequence: VPNLFMLETVDSVKLADKVNSSWQRKGSPERLKVMVQINTSGEESKHGLPPSETIAIVEHINAKCPNLEFVGLMT
• Gene ID - Mouse: ENSMUSG00000031485
• Gene ID - Rat: ENSRNOG00000013751
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PROSC pAb (ATL-HPA023646 w/enhanced validation) – 2 Found

Darin, Niklas; Reid, Emma; Prunetti, Laurence; Samuelsson, Lena; Husain, Ralf A; Wilson, Matthew; El Yacoubi, Basma; Footitt, Emma; Chong, W K; Wilson, Louise C; Prunty, Helen; Pope, Simon; Heales, Simon; Lascelles, Karine; Champion, Mike; Wassmer, Evangeline; Veggiotti, Pierangelo; de Crécy-Lagard, Valérie; Mills, Philippa B; Clayton, Peter T. Mutations in PROSC Disrupt Cellular Pyridoxal Phosphate Homeostasis and Cause Vitamin-B(6)-Dependent Epilepsy. American Journal Of Human Genetics. 2016;99(6):1325-1337. 

Pal, Maitou; Lace, Baiba; Labrie, Yvan; Laflamme, Nathalie; Rioux, Nadie; Setty, Samarth Thonta; Dugas, Marc-Andre; Gosselin, Louise; Droit, Arnaud; Chrestian, Nicolas; Rivest, Serge. A founder mutation in the PLPBP gene in families from Saguenay-Lac-St-Jean region affected by a pyridoxine-dependent epilepsy. Jimd Reports. 2021;59(1):32-41.