Anti PROS1 pAb (ATL-HPA007724 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA007724-25

Protein Description: protein S (alpha)
Gene Name: PROS1
Alternative Gene Name: PROS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022912: 75%, ENSRNOG00000048723: 72%
Entrez Gene ID: 5627
Uniprot ID: P07225
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QGASGIKEIIQEKQNKHCLVTVEKGSYYPGSGIAQFHIDYNNVSSAEGWHVNVTLNIRPSTGTGVMLALVSGNNTVPFAVSLVDSTSEKSQDILLSVENTVIYRIQALSLCSDQQSHLEFRVNR
• Gene Sequence: QGASGIKEIIQEKQNKHCLVTVEKGSYYPGSGIAQFHIDYNNVSSAEGWHVNVTLNIRPSTGTGVMLALVSGNNTVPFAVSLVDSTSEKSQDILLSVENTVIYRIQALSLCSDQQSHLEFRVNR
• Gene ID - Mouse: ENSMUSG00000022912
• Gene ID - Rat: ENSRNOG00000048723
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PROS1 pAb (ATL-HPA007724 w/enhanced validation) – 1 Found

Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73.