Anti PRMT9 pAb (ATL-HPA036844)

Atlas Antibodies

Catalog No.: ATL-HPA036844-25

Protein Description: protein arginine methyltransferase 9
Gene Name: PRMT9
Alternative Gene Name: FLJ46629, PRMT10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037134: 92%, ENSRNOG00000012928: 89%
Entrez Gene ID: 90826
Uniprot ID: Q6P2P2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HTKSLDIEIPKHIPERVSLVVTETVDAGLFGEGIVESLIHAWEHLLLQPKTKGESANCEKYGKVIPASAVIFGMAVECAEIRRHHRVGIKDIAGIHLPT
• Gene Sequence: HTKSLDIEIPKHIPERVSLVVTETVDAGLFGEGIVESLIHAWEHLLLQPKTKGESANCEKYGKVIPASAVIFGMAVECAEIRRHHRVGIKDIAGIHLPT
• Gene ID - Mouse: ENSMUSG00000037134
• Gene ID - Rat: ENSRNOG00000012928
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.