Anti PRMT7 pAb (ATL-HPA044241)

Atlas Antibodies

Catalog No.: ATL-HPA044241-25

Protein Description: protein arginine methyltransferase 7
Gene Name: PRMT7
Alternative Gene Name: FLJ10640, KIAA1933
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060098: 90%, ENSRNOG00000000258: 91%
Entrez Gene ID: 54496
Uniprot ID: Q9NVM4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PWHNLYFWYVRTAVDQHLGPGAMVMPQAASLHAVVVEFRDLWRIRSPCGDCEGFDVHIMDDMIKRALDFRESREAEPHPLWEYPCRSLSEPWQILTFDFQQPV
• Gene Sequence: PWHNLYFWYVRTAVDQHLGPGAMVMPQAASLHAVVVEFRDLWRIRSPCGDCEGFDVHIMDDMIKRALDFRESREAEPHPLWEYPCRSLSEPWQILTFDFQQPV
• Gene ID - Mouse: ENSMUSG00000060098
• Gene ID - Rat: ENSRNOG00000000258
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PRMT7 pAb (ATL-HPA044241) – 1 Found

Srour, Nivine; Villarreal, Oscar D; Hardikar, Swanand; Yu, Zhenbao; Preston, Samuel; Miller, Wilson H Jr; Szewczyk, Magdelena M; Barsyte-Lovejoy, Dalia; Xu, Han; Chen, Taiping; Del Rincón, Sonia V; Richard, Stéphane. PRMT7 ablation stimulates anti-tumor immunity and sensitizes melanoma to immune checkpoint blockade. Cell Reports. 2022;38(13):110582.