Anti PRLHR pAb (ATL-HPA039361)

Atlas Antibodies

Catalog No.: ATL-HPA039361-25

Protein Description: prolactin releasing hormone receptor
Gene Name: PRLHR
Alternative Gene Name: GPR10, PrRPR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045052: 76%, ENSRNOG00000009922: 74%
Entrez Gene ID: 2834
Uniprot ID: P49683
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLK
• Gene Sequence: TTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLK
• Gene ID - Mouse: ENSMUSG00000045052
• Gene ID - Rat: ENSRNOG00000009922
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.