Anti PRKCI pAb (ATL-HPA038635)

Atlas Antibodies

Catalog No.: ATL-HPA038635-25

Protein Description: protein kinase C, iota
Gene Name: PRKCI
Alternative Gene Name: DXS1179E, PKCI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037643: 95%, ENSRNOG00000009652: 95%
Entrez Gene ID: 5584
Uniprot ID: P41743
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STMSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLEL
• Gene Sequence: STMSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLEL
• Gene ID - Mouse: ENSMUSG00000037643
• Gene ID - Rat: ENSRNOG00000009652
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.