Anti PRCP pAb (ATL-HPA017065)
Atlas Antibodies
- Catalog No.:
- ATL-HPA017065-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PRCP
Alternative Gene Name: HUMPCP, PCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061119: 77%, ENSRNOG00000010630: 78%
Entrez Gene ID: 5547
Uniprot ID: P42785
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KHLKRTIPGAENQPVIAIGGSYGGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFMKIVTTDFRKSGPHCSESIHRSWDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWISETWVNLAMVDYP |
| Gene Sequence | KHLKRTIPGAENQPVIAIGGSYGGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFMKIVTTDFRKSGPHCSESIHRSWDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWISETWVNLAMVDYP |
| Gene ID - Mouse | ENSMUSG00000061119 |
| Gene ID - Rat | ENSRNOG00000010630 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRCP pAb (ATL-HPA017065) | |
| Datasheet | Anti PRCP pAb (ATL-HPA017065) Datasheet (External Link) |
| Vendor Page | Anti PRCP pAb (ATL-HPA017065) at Atlas Antibodies |
| Documents & Links for Anti PRCP pAb (ATL-HPA017065) | |
| Datasheet | Anti PRCP pAb (ATL-HPA017065) Datasheet (External Link) |
| Vendor Page | Anti PRCP pAb (ATL-HPA017065) |
| Citations for Anti PRCP pAb (ATL-HPA017065) – 4 Found |
| Rinne, Petteri; Lyytikäinen, Leo-Pekka; Raitoharju, Emma; Kadiri, James J; Kholova, Ivana; Kähönen, Mika; Lehtimäki, Terho; Oksala, Niku. Pro-opiomelanocortin and its Processing Enzymes Associate with Plaque Stability in Human Atherosclerosis - Tampere Vascular Study. Scientific Reports. 2018;8(1):15078. PubMed |
| De Hert, Emilie; Bracke, An; Pintelon, Isabel; Janssens, Eline; Lambeir, Anne-Marie; Van Der Veken, Pieter; De Meester, Ingrid. Prolyl Carboxypeptidase Mediates the C-Terminal Cleavage of (Pyr)-Apelin-13 in Human Umbilical Vein and Aortic Endothelial Cells. International Journal Of Molecular Sciences. 2021;22(13) PubMed |
| Duan, Lei; Calhoun, Sarah; Perez, Ricardo E; Macias, Virgilia; Mir, Fatima; Pergande, Melissa R; Gattuso, Paolo; Borgia, Jeffrey A; Maki, Carl G. Prolyl Carboxypeptidase Maintains Receptor Tyrosine Kinase Signaling and Is a Potential Therapeutic Target in Triple Negative Breast Cancer. Cancers. 2022;14(3) PubMed |
| Duan, Lei; Calhoun, Sarah J; Perez, Ricardo E; Macias, Virgilia; Mir, Fatima; Gattuso, Paolo; Maki, Carl G. Prolylcarboxypeptidase promotes IGF1R/HER3 signaling and is a potential target to improve endocrine therapy response in estrogen receptor positive breast cancer. Cancer Biology & Therapy. 2022;23(1):1-10. PubMed |