Anti PRC1 pAb (ATL-HPA034521 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA034521-25

Protein Description: protein regulator of cytokinesis 1
Gene Name: PRC1
Alternative Gene Name: ASE1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038943: 86%, ENSRNOG00000013057: 84%
Entrez Gene ID: 9055
Uniprot ID: O43663
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KMQNMKKVIEAIRVELVQYWDQCFYSQEQRQAFAPFCAEDYTESLLQLHDAEIVRLKNYYEVHKELFEGVQKWEETWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKAFMVNGQKFMEYV
• Gene Sequence: KMQNMKKVIEAIRVELVQYWDQCFYSQEQRQAFAPFCAEDYTESLLQLHDAEIVRLKNYYEVHKELFEGVQKWEETWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKAFMVNGQKFMEYV
• Gene ID - Mouse: ENSMUSG00000038943
• Gene ID - Rat: ENSRNOG00000013057
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PRC1 pAb (ATL-HPA034521 w/enhanced validation) – 3 Found

Bu, Hualei; Li, Yingwei; Jin, Chengjuan; Yu, Hongfeng; Wang, Xiangxiang; Chen, Jingying; Wang, Yu; Ma, Yana; Zhang, Youzhong; Kong, Beihua. Overexpression of PRC1 indicates a poor prognosis in ovarian cancer. International Journal Of Oncology. 2020;56(3):685-696. 

Ma, Xi; Zhou, Lin; Zheng, Shusen. Transcriptome analysis revealed key prognostic genes and microRNAs in hepatocellular carcinoma. Peerj. 8( 32296612):e8930. 

Chen, Huaping; Wu, Junrong; Lu, Liuyi; Hu, Zuojian; Li, Xi; Huang, Li; Zhang, Xiaolian; Chen, Mingxing; Qin, Xue; Xie, Li. Identification of Hub Genes Associated With Immune Infiltration and Predict Prognosis in Hepatocellular Carcinoma via Bioinformatics Approaches. Frontiers In Genetics. 11( 33505422):575762.