Anti PPTC7 pAb (ATL-HPA040614 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA040614-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: PTC7 protein phosphatase homolog (S. cerevisiae)
Gene Name: PPTC7
Alternative Gene Name: TA-PP2C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038582: 99%, ENSRNOG00000021440: 99%
Entrez Gene ID: 160760
Uniprot ID: Q8NI37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGDIILTATDGLFDNMPDYMILQELKKLKNSNYESIQQTARSIAEQAHELAYDPNYMSPFAQFACDNGLNVRGGKPDDITVLLSIVAEY
Gene Sequence LGDIILTATDGLFDNMPDYMILQELKKLKNSNYESIQQTARSIAEQAHELAYDPNYMSPFAQFACDNGLNVRGGKPDDITVLLSIVAEY
Gene ID - Mouse ENSMUSG00000038582
Gene ID - Rat ENSRNOG00000021440
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPTC7 pAb (ATL-HPA040614 w/enhanced validation)
Datasheet Anti PPTC7 pAb (ATL-HPA040614 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PPTC7 pAb (ATL-HPA040614 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PPTC7 pAb (ATL-HPA040614 w/enhanced validation)
Datasheet Anti PPTC7 pAb (ATL-HPA040614 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PPTC7 pAb (ATL-HPA040614 w/enhanced validation)