Anti PPP6R3 pAb (ATL-HPA038468)

Atlas Antibodies

Catalog No.:
ATL-HPA038468-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: protein phosphatase 6, regulatory subunit 3
Gene Name: PPP6R3
Alternative Gene Name: C11orf23, DKFZp781E17107, DKFZp781E2374, DKFZp781O2362, FLJ11058, FLJ43065, KIAA1558, MGC125711, MGC125712, PP6R3, SAP190, SAPL, SAPLa, SAPS3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024908: 100%, ENSRNOG00000015540: 100%
Entrez Gene ID: 55291
Uniprot ID: Q5H9R7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ADQDDIGNVSFDRVSDINFTLNTNESGNIALFEACCKERIQQFDDGGSDEEDIWEEKHIAFTPESQRRSSS
Gene Sequence ADQDDIGNVSFDRVSDINFTLNTNESGNIALFEACCKERIQQFDDGGSDEEDIWEEKHIAFTPESQRRSSS
Gene ID - Mouse ENSMUSG00000024908
Gene ID - Rat ENSRNOG00000015540
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPP6R3 pAb (ATL-HPA038468)
Datasheet Anti PPP6R3 pAb (ATL-HPA038468) Datasheet (External Link)
Vendor Page Anti PPP6R3 pAb (ATL-HPA038468) at Atlas Antibodies

Documents & Links for Anti PPP6R3 pAb (ATL-HPA038468)
Datasheet Anti PPP6R3 pAb (ATL-HPA038468) Datasheet (External Link)
Vendor Page Anti PPP6R3 pAb (ATL-HPA038468)