Anti PPP6R3 pAb (ATL-HPA038468)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038468-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PPP6R3
Alternative Gene Name: C11orf23, DKFZp781E17107, DKFZp781E2374, DKFZp781O2362, FLJ11058, FLJ43065, KIAA1558, MGC125711, MGC125712, PP6R3, SAP190, SAPL, SAPLa, SAPS3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024908: 100%, ENSRNOG00000015540: 100%
Entrez Gene ID: 55291
Uniprot ID: Q5H9R7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ADQDDIGNVSFDRVSDINFTLNTNESGNIALFEACCKERIQQFDDGGSDEEDIWEEKHIAFTPESQRRSSS |
| Gene Sequence | ADQDDIGNVSFDRVSDINFTLNTNESGNIALFEACCKERIQQFDDGGSDEEDIWEEKHIAFTPESQRRSSS |
| Gene ID - Mouse | ENSMUSG00000024908 |
| Gene ID - Rat | ENSRNOG00000015540 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PPP6R3 pAb (ATL-HPA038468) | |
| Datasheet | Anti PPP6R3 pAb (ATL-HPA038468) Datasheet (External Link) |
| Vendor Page | Anti PPP6R3 pAb (ATL-HPA038468) at Atlas Antibodies |
| Documents & Links for Anti PPP6R3 pAb (ATL-HPA038468) | |
| Datasheet | Anti PPP6R3 pAb (ATL-HPA038468) Datasheet (External Link) |
| Vendor Page | Anti PPP6R3 pAb (ATL-HPA038468) |