Anti PPP4R3B pAb (ATL-HPA001233 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA001233-100

Protein Description: protein phosphatase 4, regulatory subunit 3B
Gene Name: PPP4R3B
Alternative Gene Name: FLFL2, FLJ31474, KIAA1387, PSY2, SMEK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020463: 91%, ENSRNOG00000003712: 89%
Entrez Gene ID: 57223
Uniprot ID: Q5MIZ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GQTFKGLKTKYEQEKDRQNQKLNSVPSILRSNRFRRDAKALEEDEEMWFNEDEEEEGKAVMPPLE
• Gene Sequence: GQTFKGLKTKYEQEKDRQNQKLNSVPSILRSNRFRRDAKALEEDEEMWFNEDEEEEGKAVMPPLE
• Gene ID - Mouse: ENSMUSG00000020463
• Gene ID - Rat: ENSRNOG00000003712
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PPP4R3B pAb (ATL-HPA001233 w/enhanced validation) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.