Anti PPP4R1 pAb (ATL-HPA041089 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041089-25

Protein Description: protein phosphatase 4, regulatory subunit 1
Gene Name: PPP4R1
Alternative Gene Name: PP4R1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061950: 55%, ENSRNOG00000013733: 49%
Entrez Gene ID: 9989
Uniprot ID: Q8TF05
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDAHEETISIEKRSDLQDELDINELPNCKINQEDSVPLISDAVENMDSTLHYIHSDSDLSNNSSFSPDEERRTKVQ
• Gene Sequence: LDAHEETISIEKRSDLQDELDINELPNCKINQEDSVPLISDAVENMDSTLHYIHSDSDLSNNSSFSPDEERRTKVQ
• Gene ID - Mouse: ENSMUSG00000061950
• Gene ID - Rat: ENSRNOG00000013733
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PPP4R1 pAb (ATL-HPA041089 w/enhanced validation) – 2 Found

Wu, Gang; Ma, Zhenyu; Qian, Jianmin; Liu, Bin. PP4R1 accelerates cell growth and proliferation in HepG2 hepatocellular carcinoma. Oncotargets And Therapy. 8( 26300649):2067-74. 

Qi, Yuying; Hu, Tinghui; Li, Kai; Ye, Renqing; Ye, Zuodong. Lentivirus-Mediated Short-Hairpin RNA Targeting Protein Phosphatase 4 Regulatory Subunit 1 Inhibits Growth in Breast Cancer. Journal Of Breast Cancer. 2015;18(3):218-24.