Anti PPP4C pAb (ATL-HPA043837 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043837-25

Protein Description: protein phosphatase 4, catalytic subunit
Gene Name: PPP4C
Alternative Gene Name: PP4, PPX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030697: 100%, ENSRNOG00000019813: 100%
Entrez Gene ID: 5531
Uniprot ID: P60510
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCG
• Gene Sequence: MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCG
• Gene ID - Mouse: ENSMUSG00000030697
• Gene ID - Rat: ENSRNOG00000019813
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.