Anti PPP3CC pAb (ATL-HPA023396)

Atlas Antibodies

Catalog No.: ATL-HPA023396-25

Protein Description: protein phosphatase 3, catalytic subunit, gamma isozyme
Gene Name: PPP3CC
Alternative Gene Name: CALNA3, PP2Bgamma
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022092: 59%, ENSRNOG00000009745: 58%
Entrez Gene ID: 5533
Uniprot ID: P48454
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGFSLQHKIRSFEEARGLDRINERMPPRKDSIHAGGPMKSVTSAHSHAAHRSDQGKKAHS
• Gene Sequence: RGFSLQHKIRSFEEARGLDRINERMPPRKDSIHAGGPMKSVTSAHSHAAHRSDQGKKAHS
• Gene ID - Mouse: ENSMUSG00000022092
• Gene ID - Rat: ENSRNOG00000009745
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.