Anti PPP2R5B pAb (ATL-HPA036607)

Atlas Antibodies

Catalog No.: ATL-HPA036607-25

Protein Description: protein phosphatase 2, regulatory subunit B', beta
Gene Name: PPP2R5B
Alternative Gene Name: B56B, FLJ35411, PR61B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000107330: 93%, ENSRNOG00000021025: 93%
Entrez Gene ID: 5526
Uniprot ID: Q15173
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKEAPLQRLTP
• Gene Sequence: GKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKEAPLQRLTP
• Gene ID - Mouse: ENSMUSG00000107330
• Gene ID - Rat: ENSRNOG00000021025
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PPP2R5B pAb (ATL-HPA036607) – 1 Found

Dyson, Jade J; Abbasi, Fatima; Varadkar, Prajakta; McCright, Brent. Growth arrest of PPP2R5C and PPP2R5D double knockout mice indicates a genetic interaction and conserved function for these PP2A B subunits. Faseb Bioadvances. 2022;4(4):273-282.